PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01040782.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 461aa    MW: 50875.1 Da    PI: 6.5487
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01040782.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS240.19.1e-742014352239
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++++++c +av++++    + l+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e +   s e +++++l++e++P
  AMDW01040782.1_FGP001 201 KQVIVACGKAVDENS-WYRDLLMSELRNMVSISGEPMQRLGAYMLEGLVARLSSTGHALYKSLKCKEPT---SFELMSYMHLLYEICP 284
                            788999999999855.5568899*********************************************9...99999*********** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            ++kf+++ aN aI eav+ge+ vHiiDf+i qG QW++++qaLa+Rp+gpp lRiTg+++++s   +   l  +g+rL ++A+++g+p
  AMDW01040782.1_FGP001 285 FFKFGYMSANGAIAEAVKGENFVHIIDFQIAQGSQWATMIQALAARPGGPPYLRITGIDDSNSAhaRGGGLDIVGRRLFNIAQSCGLP 372
                            ************************************************************8888889999****************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvv 239
                            fefn+ v  + +++ le+L++++gE+++Vn+++qlh+++desv +e++rd++L++vk+lsP+vv
  AMDW01040782.1_FGP001 373 FEFNA-VPAASHEVMLEHLDIRSGEVIVVNFAYQLHHTPDESVGIENHRDRILRMVKGLSPRVV 435
                            *****.799999999************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.755174461IPR005202Transcription factor GRAS
PfamPF035143.1E-71201435IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
DNNGKINSLL IVRKCIIPQR LQHINKIQKV APENMSMQAS NRPYRYPDNS QIPYYSRSSM  60
HVGQNGTYHV QQNHEDLYAS SDDGSQNGNS KAQGLQAQYC TLDSSSGNFV YPAHSSTSSH  120
ISGSPISQQD SHSEHTSGSP ASASCVTEVP GLRYTTIEEI ENAMFGPEPD TVSSDCSLLT  180
DSAFYQDNWR EHLGINTGDL KQVIVACGKA VDENSWYRDL LMSELRNMVS ISGEPMQRLG  240
AYMLEGLVAR LSSTGHALYK SLKCKEPTSF ELMSYMHLLY EICPFFKFGY MSANGAIAEA  300
VKGENFVHII DFQIAQGSQW ATMIQALAAR PGGPPYLRIT GIDDSNSAHA RGGGLDIVGR  360
RLFNIAQSCG LPFEFNAVPA ASHEVMLEHL DIRSGEVIVV NFAYQLHHTP DESVGIENHR  420
DRILRMVKGL SPRVVQKGWR GTSLLENGGQ GFQWLALGRT H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-302024386240GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104800.0AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630863.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630862.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630861.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630860.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630859.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630858.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE11e-134CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLI1P8G00.0I1P8G0_ORYGL; Uncharacterized protein
STRINGORGLA03G0065600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-114GRAS family protein